NKX2-2 Peptide - N-terminal region
NKX2-2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
NKX2.2, NKX2B
UniProt
O95096
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NKX2-2 Rabbit Polyclonal Antibody (orb574028) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002500
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040146-500 1x 500 µL
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details