Nfic Peptide - N-terminal region
Nfic Peptide - N-terminal region
Product Specifications
UniProt
P70255
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Nfic Rabbit Polyclonal Antibody (orb576555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKAEVKQKWASRLLAKLR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC883592-100 1x 100 µL
CD23 (Fc Epsilon RII) (FCER2/3592), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP08066PU-N 100 µL
Synaptotagmin 1 (SYT1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
PKSH031330-01 20 µg
Recombinant Human IL6ST/CD130 Protein (His & Fc Tag)
Sign In for Pricing
View Details