Nfic Peptide - N-terminal region
Nfic Peptide - N-terminal region
Product Specifications
UniProt
P70255
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Nfic Rabbit Polyclonal Antibody (orb576555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKAEVKQKWASRLLAKLR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680792-500 1x 500 µL
IgA Secretory Component (ECM1/792), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![PARN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D12]](https://cdn.genprice.uk/products/937/6868c3a0994c49e6dc3fb9cf/imageurl/ta802668am.webp)
TA802668AM 100 µL
PARN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D12]
Sign In for Pricing
View Details 
BNC470007-100 1x 100 µL
Cyclin D1 (DCS-6), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details