Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPAS3 Peptide - middle region

NPAS3 Peptide - middle region

Product Specifications

Product Name Alternative

MOP6, PASD6, bHLHe12

UniProt

Q8IXF0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPAS3 Rabbit Polyclonal Antibody (orb577362) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158221.1, NP_001158221

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGR2 (anterior gradient Homolog 2 (Xenopus laevis), AG2, GOB-4, HAG-2, XAG-2) (FITC)
243154-FITC 100 µL

AGR2 (anterior gradient Homolog 2 (Xenopus laevis), AG2, GOB-4, HAG-2, XAG-2) (FITC)

Sign In for Pricing
View Details
Rabbit Anti-Human c-Src (phospho Tyr529) Polyclonal Antibody
PA83977HU-01 50 µg

Rabbit Anti-Human c-Src (phospho Tyr529) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human c-Src (phospho Tyr529) Polyclonal Antibody
PA83977HU-02 100 µg

Rabbit Anti-Human c-Src (phospho Tyr529) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human c-Src (phospho Tyr529) Polyclonal Antibody
PA83977HU-03 500 µg

Rabbit Anti-Human c-Src (phospho Tyr529) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human c-Src (phospho Tyr529) Polyclonal Antibody
PA83977HU-04 1 mg

Rabbit Anti-Human c-Src (phospho Tyr529) Polyclonal Antibody

Sign In for Pricing
View Details
PRKAR2A antibody - middle region
MBS3215270-01 0.1 mL

PRKAR2A antibody - middle region

Sign In for Pricing
View Details