Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPAS3 Peptide - middle region

NPAS3 Peptide - middle region

Product Specifications

Product Name Alternative

MOP6, PASD6, bHLHe12

UniProt

Q8IXF0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPAS3 Rabbit Polyclonal Antibody (orb577362) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158221.1, NP_001158221

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Promethazine Sulfoxide
orb3054058-01 25 mg

Promethazine Sulfoxide

Sign In for Pricing
View Details
Promethazine Sulfoxide
orb3054058-02 50 mg

Promethazine Sulfoxide

Sign In for Pricing
View Details
Promethazine Sulfoxide
orb3054058-03 100 mg

Promethazine Sulfoxide

Sign In for Pricing
View Details
Promethazine Sulfoxide
orb3054058-04 5 mg

Promethazine Sulfoxide

Sign In for Pricing
View Details
4930588N13Rik Protein Vector (Mouse) (pPM-C-His)
PV149473 500 ng

4930588N13Rik Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal Moesin Antibody (MSN/492) [Dylight 594]
NBP2-47916DL594 0.1 mL

Mouse Monoclonal Moesin Antibody (MSN/492) [Dylight 594]

Sign In for Pricing
View Details