Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rapgef2 Peptide - C-terminal region

Rapgef2 Peptide - C-terminal region

Product Specifications

UniProt

Q8CHG7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAPGEF2 Rabbit Polyclonal Antibody (orb578594) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQSRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin Related Protein 2/3 Complex Subunit 4 (ARPC4) Peptide
abx615378 100 µg

Actin Related Protein 2/3 Complex Subunit 4 (ARPC4) Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal Transducin alpha Antibody [mFluor Violet 500 SE]
NB120-3504MFV500 0.1 mL

Rabbit Polyclonal Transducin alpha Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Adgrg1 (NM_018882) Mouse Recombinant Protein
TP510044 20 µg

Adgrg1 (NM_018882) Mouse Recombinant Protein

Sign In for Pricing
View Details
NLE1 CytoSection
TS404114P5 25 Slides

NLE1 CytoSection

Sign In for Pricing
View Details
IKK beta Polyclonal Antibody, Biotin Conjugated
bs-4880R-Biotin-TR 20 µL

IKK beta Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Paired Box Gene 6 (PAX6)
MBS2079813-01 0.1 mL

PE-Linked Polyclonal Antibody to Paired Box Gene 6 (PAX6)

Sign In for Pricing
View Details