Melk Peptide - N-terminal region
Melk Peptide - N-terminal region
Product Specifications
Product Name Alternative
AI327312, MPK38, mKIAA0175
UniProt
Q61846
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Melk Rabbit Polyclonal Antibody (orb330475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034920
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDALKSLRHQHIC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP322874M 100 µg
JNK1 (MAPK8) (NM_139047) Human Recombinant Protein
Sign In for Pricing
View Details 
KN402667 1 Kit
Kallikrein 2 (KLK2) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 