Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Melk Peptide - N-terminal region

Melk Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI327312, MPK38, mKIAA0175

UniProt

Q61846

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Melk Rabbit Polyclonal Antibody (orb330475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034920

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDALKSLRHQHIC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hydroxy-2-oxo-2,3-dihydro-1H-[1]benzazephe-4-carboxylic Acid Ethyl Ester
TRC-H950810-50MG 50 mg

5-Hydroxy-2-oxo-2,3-dihydro-1H-[1]benzazephe-4-carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
Recombinant QKI Antibody
RC-4822-01 50 μL

Recombinant QKI Antibody

Sign In for Pricing
View Details
Recombinant QKI Antibody
RC-4822-02 100 µL

Recombinant QKI Antibody

Sign In for Pricing
View Details
Recombinant QKI Antibody
RC-4822-03 1 mL

Recombinant QKI Antibody

Sign In for Pricing
View Details
SV2A Antibody
KC-392-01 50 μL

SV2A Antibody

Sign In for Pricing
View Details
SV2A Antibody
KC-392-02 100 µL

SV2A Antibody

Sign In for Pricing
View Details