MGA Peptide - C-terminal region
MGA Peptide - C-terminal region
Product Specifications
UniProt
Q8IWI9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MGA Rabbit Polyclonal Antibody (orb325350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ASLQMKRESQNPDQKDETNSIKREQETKKVLQSEGEAVDPEANVIKQNSG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Vasopressin (AVP) Mouse Monoclonal Antibody [Clone ID: VAS 2-10-8]](https://cdn.genprice.uk/products/937/68dd1899061270361e8fb92b/imageurl/am02260pu-n.webp)
AM02260PU-N 100 µg
Vasopressin (AVP) Mouse Monoclonal Antibody [Clone ID: VAS 2-10-8]
Sign In for Pricing
View Details 
BNC941448-500 1x 500 µL
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC473027-100 1x 100 µL
CD4 (T-Helper/Inducer Cell Marker) (CD4/3027), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-I780625-1G 1 g
5-Isobutyl-4-nitro-1H-pyrazole-3-carboxylic Acid
Sign In for Pricing
View Details