Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGSH Peptide - C-terminal region

SGSH Peptide - C-terminal region

Product Specifications

UniProt

F5H6A3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SGSH Rabbit Polyclonal Antibody (orb580285) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT3 Rabbit mAb
E2R25724 100 µL

SIRT3 Rabbit mAb

Sign In for Pricing
View Details
1700012B07Rik Double Nickase Plasmid (m2)
sc-427377-NIC-2 20 µg

1700012B07Rik Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Granzyme K Polyclonal Antibody
BT-AP03797-01 20 µL

Granzyme K Polyclonal Antibody

Sign In for Pricing
View Details
Granzyme K Polyclonal Antibody
BT-AP03797-02 50 µL

Granzyme K Polyclonal Antibody

Sign In for Pricing
View Details
Granzyme K Polyclonal Antibody
BT-AP03797-03 100 µL

Granzyme K Polyclonal Antibody

Sign In for Pricing
View Details
beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI12C1]
TA502306S 30 µL

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI12C1]

Sign In for Pricing
View Details