Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLRMT Peptide - C-terminal region

POLRMT Peptide - C-terminal region

Product Specifications

Product Name Alternative

APOLMT, MTRNAP, MTRPOL, h-mtRPOL

UniProt

O00411

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLRMT Rabbit Polyclonal Antibody (orb325408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005026

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFRRQDAQRGMRVAQVLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLAUR Human qPCR Primer Pair (NM_002659)
HP233443 200 Reactions

PLAUR Human qPCR Primer Pair (NM_002659)

Sign In for Pricing
View Details
DCAMKL1 (DCLK1) Human Gene Knockout Kit (CRISPR)
KN217050RB 1 Kit

DCAMKL1 (DCLK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Colon: transverse
CR560939 5 µg

Tissue Total RNA, Colon: transverse

Sign In for Pricing
View Details
rac 2-Cyano-2-phenylbutanamide
TRC-C982106-50MG 50 mg

rac 2-Cyano-2-phenylbutanamide

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB502448 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Human ZNF358 activation kit by CRISPRa
GA115369 1 Kit

Human ZNF358 activation kit by CRISPRa

Sign In for Pricing
View Details