Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLRMT Peptide - C-terminal region

POLRMT Peptide - C-terminal region

Product Specifications

Product Name Alternative

APOLMT, MTRNAP, MTRPOL, h-mtRPOL

UniProt

O00411

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLRMT Rabbit Polyclonal Antibody (orb325408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005026

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFRRQDAQRGMRVAQVLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benchmark Agarose HR, PCR Grade for DNA fragments between 20 to 800bp, 100g
A1801-HR 1 Each

Benchmark Agarose HR, PCR Grade for DNA fragments between 20 to 800bp, 100g

Sign In for Pricing
View Details
4-(4,6-Bis(4-((2-ethylhexyloxy)carbonyl)phenylamino)-1,3,5-triazin-2-ylamino)benzoic Acid
TRC-B433840-5MG 5 mg

4-(4,6-Bis(4-((2-ethylhexyloxy)carbonyl)phenylamino)-1,3,5-triazin-2-ylamino)benzoic Acid

Sign In for Pricing
View Details
IGF1 Receptor (IGF1R) pTyr1165/1166 Rabbit Polyclonal Antibody
AP02386PU-N 100 µL

IGF1 Receptor (IGF1R) pTyr1165/1166 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS700134 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
Mouse Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit
RDR-PTGS2-Mu-01 96 Tests

Mouse Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit

Sign In for Pricing
View Details
Mouse Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit
RDR-PTGS2-Mu-02 48 Tests

Mouse Prostaglandin Endoperoxide Synthase 2 (PTGS2) ELISA Kit

Sign In for Pricing
View Details