Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naa40 Peptide - C-terminal region

Naa40 Peptide - C-terminal region

Product Specifications

UniProt

Q8VE10

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Naa40 Rabbit Polyclonal Antibody (orb580577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EALQFEIDDSSPSMSGCCGEDCSYEILSRRTKFGDSQHSHTGGHCGGCCH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAF (CD55 Molecule, Decay Accelerating Factor for Complement (Cromer Blood Group), CR, CROM, DAF, TC) (MaxLight 750)
MBS6237853-01 0.1 mL

DAF (CD55 Molecule, Decay Accelerating Factor for Complement (Cromer Blood Group), CR, CROM, DAF, TC) (MaxLight 750)

Sign In for Pricing
View Details
DAF (CD55 Molecule, Decay Accelerating Factor for Complement (Cromer Blood Group), CR, CROM, DAF, TC) (MaxLight 750)
MBS6237853-02 5x 0.1 mL

DAF (CD55 Molecule, Decay Accelerating Factor for Complement (Cromer Blood Group), CR, CROM, DAF, TC) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Human CD232/PLXNC1 Protein, His Tag
E40KMH392 20 µg

Recombinant Human CD232/PLXNC1 Protein, His Tag

Sign In for Pricing
View Details
Rabbit Polyclonal FcgR4/CD16-2 Antibody [PE]
NBP3-05900PE 0.1 mL

Rabbit Polyclonal FcgR4/CD16-2 Antibody [PE]

Sign In for Pricing
View Details
PIWIL4 Recombinant Protein Antigen
NBP1-83491PEP 0.1 mL

PIWIL4 Recombinant Protein Antigen

Sign In for Pricing
View Details
EPAS1 ELISA Kit (Mouse)
OKCD02587-96W 96 Well

EPAS1 ELISA Kit (Mouse)

Sign In for Pricing
View Details