Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Naa40 Peptide - C-terminal region

Naa40 Peptide - C-terminal region

Product Specifications

UniProt

Q8VE10

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Naa40 Rabbit Polyclonal Antibody (orb580577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EALQFEIDDSSPSMSGCCGEDCSYEILSRRTKFGDSQHSHTGGHCGGCCH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human H2AFX (H2A Histone Family, Member X) ELISA Kit
EK246910 96 Well

Human H2AFX (H2A Histone Family, Member X) ELISA Kit

Sign In for Pricing
View Details
Rdh19 (NM_147222) Mouse Tagged ORF Clone Lentiviral Particle
MR212213L4V 200 µL

Rdh19 (NM_147222) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Mcrip2 Pre-designed siRNA Set B
SI208231B 1 Each

Rat Mcrip2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
TERGITOLTM 15-S-40 solution, 70% aqueous solution
FT184392-01 0.25 L

TERGITOLTM 15-S-40 solution, 70% aqueous solution

Sign In for Pricing
View Details
TERGITOLTM 15-S-40 solution, 70% aqueous solution
FT184392-02 0.5 L

TERGITOLTM 15-S-40 solution, 70% aqueous solution

Sign In for Pricing
View Details
Anti-RTEL1 Antibody Picoband® (FITC Conjugate)
A01544-1-FITC 100 µg/Vial

Anti-RTEL1 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details