TMC7 Peptide - N-terminal region
TMC7 Peptide - N-terminal region
Product Specifications
UniProt
E7ERB6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMC7 Rabbit Polyclonal Antibody (orb580905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001153836
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SWKRFLEKAREMTTHLELWREDIRSIEGKFGTGIQSYFSFLRFLVLLNLV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
127901Q2-AAT 500 Tests
PE/iFluor® 750 Anti-human CD279 Antibody *3D1*
Sign In for Pricing
View Details 
TL703206V 500 µL Each
Irf7 Rat shRNA Lentiviral Particle (Locus ID 293624)
Sign In for Pricing
View Details