Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMC7 Peptide - N-terminal region

TMC7 Peptide - N-terminal region

Product Specifications

UniProt

E7ERB6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMC7 Rabbit Polyclonal Antibody (orb580905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001153836

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SWKRFLEKAREMTTHLELWREDIRSIEGKFGTGIQSYFSFLRFLVLLNLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Fas Ligand ELISA Kit
MBS010535-01 48 Well

Bovine Fas Ligand ELISA Kit

Sign In for Pricing
View Details
Bovine Fas Ligand ELISA Kit
MBS010535-02 96 Well

Bovine Fas Ligand ELISA Kit

Sign In for Pricing
View Details
Bovine Fas Ligand ELISA Kit
MBS010535-03 5x 96 Well

Bovine Fas Ligand ELISA Kit

Sign In for Pricing
View Details
Bovine Fas Ligand ELISA Kit
MBS010535-04 10x 96 Well

Bovine Fas Ligand ELISA Kit

Sign In for Pricing
View Details
GRAF (ARHGAP26) (NM_015071) Human Over-expression Lysate
LC414809 20 µg

GRAF (ARHGAP26) (NM_015071) Human Over-expression Lysate

Sign In for Pricing
View Details
Pentane-1,5-diamine dihydrochloride
orb1302470-01 200 mg

Pentane-1,5-diamine dihydrochloride

Sign In for Pricing
View Details