Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POGLUT1 Peptide - N-terminal region

POGLUT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C3orf9, CLP46, KDELCL1, KTELC1, MDSRP, Rumi, hCLP46

UniProt

Q8NBL1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POGLUT1 Rabbit Polyclonal Antibody (orb325659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689518

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLLPSAQGRQKESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAKD1 Antibody
8C11173-AAT 50 µg

FAKD1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS703106 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
Frozen Tissue Sections, Smooth muscle
CS502458 5x 5 µm

Frozen Tissue Sections, Smooth muscle

Sign In for Pricing
View Details