POGLUT1 Peptide - N-terminal region
POGLUT1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C3orf9, CLP46, KDELCL1, KTELC1, MDSRP, Rumi, hCLP46
UniProt
Q8NBL1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POGLUT1 Rabbit Polyclonal Antibody (orb325659) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689518
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLLPSAQGRQKESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CLACHE100-4 1000 Tests
Bioluminescent Acetylcholinesterase Assay Kit
Sign In for Pricing
View Details 
AP21181PU-N 100 µg
Glutamate receptor ionotropic, NMDA 2D (GRIN2D) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
TA392896 100 µL
Serum Response Factor (SRF) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details