TWF2 Peptide - C-terminal region
TWF2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
A6RP, A6r, PTK9L
UniProt
Q6IBS0
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TWF2 Rabbit Polyclonal Antibody (orb581667) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_009215
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENG
More Discoveries
Explore Other Products
Browse additional items from our catalog
136515 50 µg
USP7 (Ubiquitin specific peptidase 7 (herpes virus-associated), HAUSP, Herpes virus-associated ubiquitin-specific protease, TEF1, Ubiquitin-specific-processing protease 7) discontinued
Sign In for Pricing
View Details 
