Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eps8 Peptide - C-terminal region

Eps8 Peptide - C-terminal region

Product Specifications

UniProt

Q3TMV3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPS8 Rabbit Polyclonal Antibody (orb330776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFNQITVQKAALEDSNGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Jerky protein homolog-like (JERKL), Biotinylated
orb3008134-01 20 µg

Recombinant Human Jerky protein homolog-like (JERKL), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Jerky protein homolog-like (JERKL), Biotinylated
orb3008134-02 100 µg

Recombinant Human Jerky protein homolog-like (JERKL), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Jerky protein homolog-like (JERKL), Biotinylated
orb3008134-03 1 mg

Recombinant Human Jerky protein homolog-like (JERKL), Biotinylated

Sign In for Pricing
View Details
ARHGEF11 Rabbit Polyclonal Antibody
TA373661 100 µL

ARHGEF11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD49b Antibody (APC)
abx200343 100 Tests

CD49b Antibody (APC)

Sign In for Pricing
View Details
TAF9 Rabbit pAb (APR24549N)
APR24549N-01 50 µL

TAF9 Rabbit pAb (APR24549N)

Sign In for Pricing
View Details