Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eps8 Peptide - C-terminal region

Eps8 Peptide - C-terminal region

Product Specifications

UniProt

Q3TMV3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPS8 Rabbit Polyclonal Antibody (orb330776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFNQITVQKAALEDSNGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF21 (Fibroblast Growth Factor 21, FGF-21, UNQ3115/PRO10196) (HRP)
MBS6378508-01 0.1 mL

FGF21 (Fibroblast Growth Factor 21, FGF-21, UNQ3115/PRO10196) (HRP)

Sign In for Pricing
View Details
FGF21 (Fibroblast Growth Factor 21, FGF-21, UNQ3115/PRO10196) (HRP)
MBS6378508-02 5x 0.1 mL

FGF21 (Fibroblast Growth Factor 21, FGF-21, UNQ3115/PRO10196) (HRP)

Sign In for Pricing
View Details
Horse Protein Kinase C Epsilon ELISA Kit
MBS009931-01 48 Well

Horse Protein Kinase C Epsilon ELISA Kit

Sign In for Pricing
View Details
Horse Protein Kinase C Epsilon ELISA Kit
MBS009931-02 96 Well

Horse Protein Kinase C Epsilon ELISA Kit

Sign In for Pricing
View Details
Horse Protein Kinase C Epsilon ELISA Kit
MBS009931-03 5x 96 Well

Horse Protein Kinase C Epsilon ELISA Kit

Sign In for Pricing
View Details
Horse Protein Kinase C Epsilon ELISA Kit
MBS009931-04 10x 96 Well

Horse Protein Kinase C Epsilon ELISA Kit

Sign In for Pricing
View Details