Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMIGO2 Peptide - N-terminal region

AMIGO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALI1, AMIGO-2, DEGA

UniProt

Q86SJ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMIGO2 Rabbit Polyclonal Antibody (orb582900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_862830

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diap3-set siRNA/shRNA/RNAi Lentivector (Mouse)
18217094 4x 500 ng

Diap3-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Astilbin
C17363 25 mg

Astilbin

Sign In for Pricing
View Details
Recombinant Clostridium Difficile rsmA Protein (aa 1-289)
VAng-Lsx9348-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Difficile rsmA Protein (aa 1-289)

Sign In for Pricing
View Details
TMCO5B Protein Vector (Human) (pPB-C-His)
PV135890 500 ng

TMCO5B Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Human hsa-miR-6795-5p miRNA Agomir
abx882253-01 5 nmol

Human hsa-miR-6795-5p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-6795-5p miRNA Agomir
abx882253-02 10 nmol

Human hsa-miR-6795-5p miRNA Agomir

Sign In for Pricing
View Details