Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMIGO2 Peptide - N-terminal region

AMIGO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALI1, AMIGO-2, DEGA

UniProt

Q86SJ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMIGO2 Rabbit Polyclonal Antibody (orb582900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_862830

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Blood Genomic DNA Extraction MAXI Kit (24 prep) (With Proteinase K Powder, for wide applications and simple procedure)
FABGK_003-1 1 Kit

Blood Genomic DNA Extraction MAXI Kit (24 prep) (With Proteinase K Powder, for wide applications and simple procedure)

Sign In for Pricing
View Details
Human Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit
MBS451109-01 48 Tests

Human Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit

Sign In for Pricing
View Details
Human Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit
MBS451109-02 96 Tests

Human Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit

Sign In for Pricing
View Details
Human Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit
MBS451109-03 5x 96 Tests

Human Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit

Sign In for Pricing
View Details
Human Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit
MBS451109-04 10x 96 Tests

Human Lysophosphatidylcholine Acyltransferase 2 (LPCAT2) ELISA Kit

Sign In for Pricing
View Details
SMARCE1 (NM_003079) Human Tagged ORF Clone Lentiviral Particle
RC209444L2V 200 µL

SMARCE1 (NM_003079) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details