Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASS4 Peptide - N-terminal region

CASS4 Peptide - N-terminal region

Product Specifications

UniProt

Q9NQ75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASS4 Rabbit Polyclonal Antibody (orb583545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hist1h2ba sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3110802 1.0 µg DNA

Hist1h2ba sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Cytokeratin 19 Rabbit Polyclonal Antibody (Cy7)
orb1049296 100 µL

Cytokeratin 19 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY)
MBS7026592-01 0.02 mg

Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY)
MBS7026592-02 0.1 mg

Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY)
MBS7026592-03 5x 0.1 mg

Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY)

Sign In for Pricing
View Details
BRCA2 Rabbit pAb, FITC conjugated
orb2979194 100 µL

BRCA2 Rabbit pAb, FITC conjugated

Sign In for Pricing
View Details