Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASS4 Peptide - N-terminal region

CASS4 Peptide - N-terminal region

Product Specifications

UniProt

Q9NQ75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASS4 Rabbit Polyclonal Antibody (orb583545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human INSIG1 siRNA
abx902691-01 15 nmol

Human INSIG1 siRNA

Sign In for Pricing
View Details
Human INSIG1 siRNA
abx902691-02 30 nmol

Human INSIG1 siRNA

Sign In for Pricing
View Details
ZNF600 Protein Vector (Human) (pPB-C-His)
PV145218 500 ng

ZNF600 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CDK4 (BSA & Azide Free) (MaxLight 490)
MBS6267415-01 0.1 mL

CDK4 (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
CDK4 (BSA & Azide Free) (MaxLight 490)
MBS6267415-02 5x 0.1 mL

CDK4 (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details
NECAB2, NT (NECAB2, EFCBP2, N-terminal EF-hand calcium-binding protein 2, Neuronal calcium-binding protein 2, Synaptotagmin-interacting protein 2) (AP) discontinued
038874-AP 200 µL

NECAB2, NT (NECAB2, EFCBP2, N-terminal EF-hand calcium-binding protein 2, Neuronal calcium-binding protein 2, Synaptotagmin-interacting protein 2) (AP) discontinued

Sign In for Pricing
View Details