CASP4 Peptide - middle region
CASP4 Peptide - middle region
Product Specifications
Product Name Alternative
ICE (rel) II, ICEREL-II, ICH-2, Mih1/TX, TX
UniProt
P49662
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CASP4 Rabbit Polyclonal Antibody (orb331012) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_150649
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGEL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9323106-01 48 Well
Human ATP-binding cassette sub-family G member 1, ABCG1 ELISA Kit
Sign In for Pricing
View Details MBS9323106-02 96 Well
Human ATP-binding cassette sub-family G member 1, ABCG1 ELISA Kit
Sign In for Pricing
View Details MBS9323106-03 5x 96 Well
Human ATP-binding cassette sub-family G member 1, ABCG1 ELISA Kit
Sign In for Pricing
View Details MBS9323106-04 10x 96 Well
Human ATP-binding cassette sub-family G member 1, ABCG1 ELISA Kit
Sign In for Pricing
View Details