USP6 Peptide - C-terminal region
USP6 Peptide - C-terminal region
Product Specifications
UniProt
P35125
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with USP6 Rabbit Polyclonal Antibody (orb584302) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NHSEEDSTDDQREDTHIKPIYNLYAISCHSGILSGGHYITYAKNPNCKWY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2047-100 1x 100 µL
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2047), 0.2mg/mL
Sign In for Pricing
View Details 
TP720108L 500 µg
BD2 (DEFB4A) (NM_004942) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC400969-100 1x 100 µL
Ep-CAM / CD326 (Cocktail PAN-EpCAM), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 