Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cops3 Peptide - C-terminal region

Cops3 Peptide - C-terminal region

Product Specifications

UniProt

Q68FW9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cops3 Rabbit Polyclonal Antibody (orb331036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004200

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Serine protease inhibitor Kazal-type 14 (SPINK14) ELISA Kit
abx528740 96 Tests

Human Serine protease inhibitor Kazal-type 14 (SPINK14) ELISA Kit

Sign In for Pricing
View Details
FS Pro DNA Lib Prep Kit V2
RK20275-01 96 Reactions

FS Pro DNA Lib Prep Kit V2

Sign In for Pricing
View Details
FS Pro DNA Lib Prep Kit V2
RK20275-02 24 Reactions

FS Pro DNA Lib Prep Kit V2

Sign In for Pricing
View Details
Recombinant Rickettsia peacockii tRNA pseudouridine synthase B (truB)
MBS1050988-01 0.02 mg (E-Coli)

Recombinant Rickettsia peacockii tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details
Recombinant Rickettsia peacockii tRNA pseudouridine synthase B (truB)
MBS1050988-02 0.02 mg (Yeast)

Recombinant Rickettsia peacockii tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details
Recombinant Rickettsia peacockii tRNA pseudouridine synthase B (truB)
MBS1050988-03 0.1 mg (E-Coli)

Recombinant Rickettsia peacockii tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details