Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cops3 Peptide - C-terminal region

Cops3 Peptide - C-terminal region

Product Specifications

UniProt

Q68FW9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cops3 Rabbit Polyclonal Antibody (orb331036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004200

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cardiotrophin Like Cytokine Factor 1 (CLCF1) CLIA Kit
EKN50933 96 Tests

Human Cardiotrophin Like Cytokine Factor 1 (CLCF1) CLIA Kit

Sign In for Pricing
View Details
Human PRR20D Protein Lysate 20ug
IHUPRR20DPLLY20UG 20 µg

Human PRR20D Protein Lysate 20ug

Sign In for Pricing
View Details
Anti-HBsAg Monoclonal Antibody, Clone IT-110H6
MBS430260-01 0.1 mg

Anti-HBsAg Monoclonal Antibody, Clone IT-110H6

Sign In for Pricing
View Details
Anti-HBsAg Monoclonal Antibody, Clone IT-110H6
MBS430260-02 5x 0.1 mg

Anti-HBsAg Monoclonal Antibody, Clone IT-110H6

Sign In for Pricing
View Details
Recombinant HCMV/HHV-5 UL123/IE1 Protein, N-GST & C-His
AP97259 50 µg

Recombinant HCMV/HHV-5 UL123/IE1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Lentiviral human PIP4P1 shRNA (UAS) - Lentiviral human PIP4P1 shRNA (UAS) plasmid
GTR15116047 1 Vial

Lentiviral human PIP4P1 shRNA (UAS) - Lentiviral human PIP4P1 shRNA (UAS) plasmid

Sign In for Pricing
View Details