Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GADL1 Peptide - middle region

GADL1 Peptide - middle region

Product Specifications

UniProt

Q6ZQY3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GADL1 Rabbit Polyclonal Antibody (orb584388) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997242

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLLKKCYSAKASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prkar2a-set siRNA/shRNA/RNAi Lentivector (Rat)
37633096 4x 500 ng

Prkar2a-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Olfr1249 Lentiviral Activation Particles (m)
sc-434318-LAC 200 µL

Olfr1249 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Atxn7 Rabbit Polyclonal Antibody (Fluoro488)
orb3086574 200 µL

Atxn7 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Human PDCD5 Recombinant Protein (N-His)
HD939012-01 50 µg

Human PDCD5 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human PDCD5 Recombinant Protein (N-His)
HD939012-02 100 µg

Human PDCD5 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human PDCD5 Recombinant Protein (N-His)
HD939012-03 1 mg

Human PDCD5 Recombinant Protein (N-His)

Sign In for Pricing
View Details