Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRM3 Peptide - N-terminal region

GRM3 Peptide - N-terminal region

Product Specifications

UniProt

F5GYZ2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRM3 Rabbit Polyclonal Antibody (orb584391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NHRNPWFRDFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-eIF2B epsilon (Ser539) Rabbit pAb, BF700 conjugated
orb2887115 100 µL

Phospho-eIF2B epsilon (Ser539) Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
MFluor™ UV375 maleimide
1601-AAT 1 mg

MFluor™ UV375 maleimide

Sign In for Pricing
View Details
IscU1/2 shRNA Plasmid (h)
sc-270108-SH 20 µg

IscU1/2 shRNA Plasmid (h)

Sign In for Pricing
View Details
3-Chloro-2-fluorophenylacetic acid
PC0133-01 1 g

3-Chloro-2-fluorophenylacetic acid

Sign In for Pricing
View Details
3-Chloro-2-fluorophenylacetic acid
PC0133-02 5 g

3-Chloro-2-fluorophenylacetic acid

Sign In for Pricing
View Details
3-Chloro-2-fluorophenylacetic acid
PC0133-03 10 g

3-Chloro-2-fluorophenylacetic acid

Sign In for Pricing
View Details