Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRM3 Peptide - N-terminal region

GRM3 Peptide - N-terminal region

Product Specifications

UniProt

F5GYZ2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRM3 Rabbit Polyclonal Antibody (orb584391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NHRNPWFRDFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD20/MS4A1 (DXLr120) Biosimilar (Monoclonal, IgG)
A135826 100 µL

Anti-CD20/MS4A1 (DXLr120) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
Granulin Rabbit pAb
E45R26092N 50 ul

Granulin Rabbit pAb

Sign In for Pricing
View Details
EIF4A1P13 ORF Vector (Human) (pORF)
ORF018813 1.0 µg DNA

EIF4A1P13 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human TSPAN30 ELISA Kit (Ready to Use)
orb552559-01 48 Tests

Human TSPAN30 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human TSPAN30 ELISA Kit (Ready to Use)
orb552559-02 96 Tests

Human TSPAN30 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
RB1, ID (Retinoblastoma-associated protein, PP110, P105-RB, RB, RB1, ) (MaxLight 405) discontinued
040868-ML405 100 µL

RB1, ID (Retinoblastoma-associated protein, PP110, P105-RB, RB, RB1, ) (MaxLight 405) discontinued

Sign In for Pricing
View Details