Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRM3 Peptide - N-terminal region

GRM3 Peptide - N-terminal region

Product Specifications

UniProt

F5GYZ2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRM3 Rabbit Polyclonal Antibody (orb584391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NHRNPWFRDFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHLDA2 Antibody
GWB-MV177F 50 µg

PHLDA2 Antibody

Sign In for Pricing
View Details
Gpr88 ORF Vector (Rat) (pORF)
ORF067829 1.0 µg DNA

Gpr88 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Monoclonal Antibody to Rhodopsin (Clone: B630)
34-1107-100 100 µL

Monoclonal Antibody to Rhodopsin (Clone: B630)

Sign In for Pricing
View Details
Neutrophil Elastase (h) -PR
sc-36042-PR 10 µM - 20 µL

Neutrophil Elastase (h) -PR

Sign In for Pricing
View Details
RPA Interacting Protein Antibody
253684 0.1 mg

RPA Interacting Protein Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD62L Antibody
RD20241F-01 25 µg

FITC Anti-Mouse CD62L Antibody

Sign In for Pricing
View Details