Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRM3 Peptide - N-terminal region

GRM3 Peptide - N-terminal region

Product Specifications

UniProt

F5GYZ2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRM3 Rabbit Polyclonal Antibody (orb584391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NHRNPWFRDFWEQKFQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SET and MYND domain-containing protein 5, SMYD5 ELISA KIT
ELI-53274h 96 Tests

Human SET and MYND domain-containing protein 5, SMYD5 ELISA KIT

Sign In for Pricing
View Details
ANKRD1 ELISA Kit (Mouse)
OKDD00781-96W 96 Tests

ANKRD1 ELISA Kit (Mouse)

Sign In for Pricing
View Details
P2Y1 Receptor (P2RY1) (C-terminus) (Biotin)
P1003-25A-Biotin 100 µL

P2Y1 Receptor (P2RY1) (C-terminus) (Biotin)

Sign In for Pricing
View Details
3-[ (3-Methoxyphenyl) amino]propanoic acid
DAA33467-01 250 mg

3-[ (3-Methoxyphenyl) amino]propanoic acid

Sign In for Pricing
View Details
3-[ (3-Methoxyphenyl) amino]propanoic acid
DAA33467-02 2.5 g

3-[ (3-Methoxyphenyl) amino]propanoic acid

Sign In for Pricing
View Details
Human DPCR-1 Alexa Fluor 750 Antibody (Clone 213201)
FAB3347S-100UG 100 µg

Human DPCR-1 Alexa Fluor 750 Antibody (Clone 213201)

Sign In for Pricing
View Details