Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTNG1 Peptide - C-terminal region

NTNG1 Peptide - C-terminal region

Product Specifications

UniProt

Q9Y2I2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NTNG1 Rabbit Polyclonal Antibody (orb326337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (C81/2885R), CF568 conjugate, 0.1mg/mL
BNC682885-100 1x 100 µL

CD81 / TAPA-1 (C81/2885R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HGF Polyclonal Antibody
E-AB-60245-01 60 µL

HGF Polyclonal Antibody

Sign In for Pricing
View Details
HGF Polyclonal Antibody
E-AB-60245-02 120 µL

HGF Polyclonal Antibody

Sign In for Pricing
View Details
HGF Polyclonal Antibody
E-AB-60245-03 200 µL

HGF Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: left
CB603518 1 Block

Frozen Tissue Blocks, Ovary: left

Sign In for Pricing
View Details
LRIG1 Human Gene Knockout Kit (CRISPR)
KN223584RB 1 Kit

LRIG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details