PANK2 Peptide - middle region
PANK2 Peptide - middle region
Product Specifications
UniProt
Q9BZ23
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PANK2 Rabbit Polyclonal Antibody (orb584824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FGLPGWAVASSFGNMMSKEKREAVSKEDLARATLITITNNIGSIARMCAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A09683-1-APC 100 µg/Vial
Anti-UBXN1 Antibody Picoband® APC Conjugated
Sign In for Pricing
View Details 
orb1096614-01 20 µg
Recombinant Human Tyrosine-protein kinase BTK (BTK)
Sign In for Pricing
View Details orb1096614-02 100 µg
Recombinant Human Tyrosine-protein kinase BTK (BTK)
Sign In for Pricing
View Details orb1096614-03 1 mg
Recombinant Human Tyrosine-protein kinase BTK (BTK)
Sign In for Pricing
View Details