PANK2 Peptide - middle region
PANK2 Peptide - middle region
Product Specifications
UniProt
Q9BZ23
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PANK2 Rabbit Polyclonal Antibody (orb584824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FGLPGWAVASSFGNMMSKEKREAVSKEDLARATLITITNNIGSIARMCAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E3565-13F-Biotin 100 µL
Estrogen-Related Receptor, alpha (ERRa, NR3B1, NR3 Steroid Receptor) (Biotin)
Sign In for Pricing
View Details 
GR134019 50 µg
Genorise® Biotinylated Bovine H-FABP polyclonal antibody
Sign In for Pricing
View Details A11148-1-HRP 100 µg/Vial
Anti-PALMD Antibody Picoband®, HRP Conjugate
Sign In for Pricing
View Details