Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5RAP3 Peptide - C-terminal region

CDK5RAP3 Peptide - C-terminal region

Product Specifications

UniProt

F5H3I5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK5RAP3 Rabbit Polyclonal Antibody (orb585182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF II p18 Rabbit Polyclonal Antibody
E28PT4528 100 µL

TAF II p18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCDC127 Knockout HEK293T Polyclonal Cells
ARG42917 1 Million

CCDC127 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
FIOULDOM.450X52RL-T1-LL-P18 Pipe Markers for Other Liquids
N001173 30 Pack (30 Marker (s) x 1 Roll)

FIOULDOM.450X52RL-T1-LL-P18 Pipe Markers for Other Liquids

Sign In for Pricing
View Details
Collagen 3 Polyclonal Antibody
bs-0948R-TR 20 µL

Collagen 3 Polyclonal Antibody

Sign In for Pricing
View Details
CD40 Mouse Monoclonal Antibody [Clone ID: OTI9D8]
TA807682S 30 µL

CD40 Mouse Monoclonal Antibody [Clone ID: OTI9D8]

Sign In for Pricing
View Details
Mouse Trav12n-3 activation kit by CRISPRa
GA218404 1 Kit

Mouse Trav12n-3 activation kit by CRISPRa

Sign In for Pricing
View Details