Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5RAP3 Peptide - C-terminal region

CDK5RAP3 Peptide - C-terminal region

Product Specifications

UniProt

F5H3I5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK5RAP3 Rabbit Polyclonal Antibody (orb585182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELF4 siRNA Oligos set (Human)
15856171 3x 5 nmol

CELF4 siRNA Oligos set (Human)

Sign In for Pricing
View Details
SLC38A10 Protein Vector (Mouse) (pPM-C-HA)
44167025 500 ng

SLC38A10 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human POGLUT3 shRNA (UAS) - Lentiviral human POGLUT3 shRNA (UAS) (100)
GTR15119322 1 Vial

Lentiviral human POGLUT3 shRNA (UAS) - Lentiviral human POGLUT3 shRNA (UAS) (100)

Sign In for Pricing
View Details
CD3E Antibody
orb1316152-01 30 µL

CD3E Antibody

Sign In for Pricing
View Details
CD3E Antibody
orb1316152-02 50 μL

CD3E Antibody

Sign In for Pricing
View Details
CD3E Antibody
orb1316152-03 100 µL

CD3E Antibody

Sign In for Pricing
View Details