Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5RAP3 Peptide - C-terminal region

CDK5RAP3 Peptide - C-terminal region

Product Specifications

UniProt

F5H3I5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK5RAP3 Rabbit Polyclonal Antibody (orb585182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATXN7L3B Polyclonal Antibody, APC Conjugated
bs-9754R-APC 100 µL

ATXN7L3B Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Creb3l2 (NM_001012188) Rat Tagged ORF Clone Lentiviral Particle
RR208758L3V 200 µL

Creb3l2 (NM_001012188) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6, DJ4, DKFZp566D0824, DnaJ, FLJ42837, HHDJ1, HSJ-2, HSJ2, MGC1152, MGC117297, MRJ, MSJ-1) (Biotin)
MBS6173157-01 0.1 mL

DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6, DJ4, DKFZp566D0824, DnaJ, FLJ42837, HHDJ1, HSJ-2, HSJ2, MGC1152, MGC117297, MRJ, MSJ-1) (Biotin)

Sign In for Pricing
View Details
DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6, DJ4, DKFZp566D0824, DnaJ, FLJ42837, HHDJ1, HSJ-2, HSJ2, MGC1152, MGC117297, MRJ, MSJ-1) (Biotin)
MBS6173157-02 5x 0.1 mL

DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6, DJ4, DKFZp566D0824, DnaJ, FLJ42837, HHDJ1, HSJ-2, HSJ2, MGC1152, MGC117297, MRJ, MSJ-1) (Biotin)

Sign In for Pricing
View Details
Anti-DCK Antibody BIOTIN
STJ500742 100 µg

Anti-DCK Antibody BIOTIN

Sign In for Pricing
View Details
Recombinant Canine Interleukin-2 Receptor Subunit Alpha (IL2RA), C-His
AP7F486-01 1 mg

Recombinant Canine Interleukin-2 Receptor Subunit Alpha (IL2RA), C-His

Sign In for Pricing
View Details