Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5RAP3 Peptide - C-terminal region

CDK5RAP3 Peptide - C-terminal region

Product Specifications

UniProt

F5H3I5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK5RAP3 Rabbit Polyclonal Antibody (orb585182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Sodium/potassium/calcium exchanger 1 (SLC24A1) ELISA Kit
MBS7218652-01 48 Well

Chicken Sodium/potassium/calcium exchanger 1 (SLC24A1) ELISA Kit

Sign In for Pricing
View Details
Chicken Sodium/potassium/calcium exchanger 1 (SLC24A1) ELISA Kit
MBS7218652-02 96 Well

Chicken Sodium/potassium/calcium exchanger 1 (SLC24A1) ELISA Kit

Sign In for Pricing
View Details
Chicken Sodium/potassium/calcium exchanger 1 (SLC24A1) ELISA Kit
MBS7218652-03 5x 96 Well

Chicken Sodium/potassium/calcium exchanger 1 (SLC24A1) ELISA Kit

Sign In for Pricing
View Details
Chicken Sodium/potassium/calcium exchanger 1 (SLC24A1) ELISA Kit
MBS7218652-04 10x 96 Well

Chicken Sodium/potassium/calcium exchanger 1 (SLC24A1) ELISA Kit

Sign In for Pricing
View Details
Dog TSH-alpha/Beta Heterodimer Monoclonal Antibody, AbBy Fluor™ 555 Conjugated
bsm-43168M-BF555 100 µL

Dog TSH-alpha/Beta Heterodimer Monoclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Anti-CASK Antibody
MBS8245699-01 0.03 mL

Anti-CASK Antibody

Sign In for Pricing
View Details