KIF1BP Peptide - N-terminal region
KIF1BP Peptide - N-terminal region
Product Specifications
Product Name Alternative
KBP, mKIAA1279, 0710007C18Rik, 2510003E04Rik
UniProt
Q6ZPU9
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIF1BP Rabbit Polyclonal Antibody (orb585308) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RVELHKNPEKEPYKSKYGARALLEEVRALLGPAPEDEDEPAADDGPGDQA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470826-100 1x 100 µL
Ep-CAM / CD326 (EGP40/826), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details