Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL21A1 Peptide - C-terminal region

COL21A1 Peptide - C-terminal region

Product Specifications

UniProt

Q96P44

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL21A1 Rabbit Polyclonal Antibody (orb585318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGEPGYMGLPGIQGKKGDKGNQGEKGIQGQKGENGRQGIPGQQGIQGHHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Mucin 6 ELISA Kit
MBS085803-01 48 Well

Porcine Mucin 6 ELISA Kit

Sign In for Pricing
View Details
Porcine Mucin 6 ELISA Kit
MBS085803-02 96 Well

Porcine Mucin 6 ELISA Kit

Sign In for Pricing
View Details
Porcine Mucin 6 ELISA Kit
MBS085803-03 5x 96 Well

Porcine Mucin 6 ELISA Kit

Sign In for Pricing
View Details
Porcine Mucin 6 ELISA Kit
MBS085803-04 10x 96 Well

Porcine Mucin 6 ELISA Kit

Sign In for Pricing
View Details
TK Antibody, Biotin conjugated
A36653-100UG 100 µg

TK Antibody, Biotin conjugated

Sign In for Pricing
View Details
Recombinant Human PIN1 / Rotamase Pin1 Protein
ARP8192-01 10 µg

Recombinant Human PIN1 / Rotamase Pin1 Protein

Sign In for Pricing
View Details