PTPRT Peptide - middle region
PTPRT Peptide - middle region
Product Specifications
Product Name Alternative
RPTPrho
UniProt
O14522
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTPRT Rabbit Polyclonal Antibody (orb331231) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_008981.4
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGG
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0028872 96 Tests
Multiplex Assay Kit for Glucose Transporter 4 (GLUT4), etc. by FLIA (Flow Luminescence Immunoassay)
Sign In for Pricing
View Details 
K2744706 1.0 µg DNA
ZZZ3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details