Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF1A Peptide - C-terminal region

HNF1A Peptide - C-terminal region

Product Specifications

UniProt

E0YMI9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNF1A Rabbit Polyclonal Antibody (orb573725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Aminobenzamide
TRC-A587100-100MG 100 mg

2-Aminobenzamide

Sign In for Pricing
View Details
Zfp58 Mouse Gene Knockout Kit (CRISPR)
KN519888 1 Kit

Zfp58 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-(Quinoline-8-sulfonamido)benzoic Acid
TRC-E592265-25MG 25 mg

4-(Quinoline-8-sulfonamido)benzoic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS501106 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Trichloro Bisphenol S
TRC-T896866-5MG 5 mg

Trichloro Bisphenol S

Sign In for Pricing
View Details
Anti-Mouse CD8a (53-6.7) In Vivo Antibody - Low Endotoxin
ICH1044-25mg 25 mg

Anti-Mouse CD8a (53-6.7) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details