HNF1A Peptide - C-terminal region
HNF1A Peptide - C-terminal region
Product Specifications
UniProt
E0YMI9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HNF1A Rabbit Polyclonal Antibody (orb573725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP313868M 100 µg
MEK7 (MAP2K7) (NM_145185) Human Recombinant Protein
Sign In for Pricing
View Details 
