Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDIT3 Peptide - N-terminal region

DDIT3 Peptide - N-terminal region

Product Specifications

UniProt

F8VS99

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDIT3 Rabbit Polyclonal Antibody (orb573857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001181985

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HORMA domain-containing protein 1 (HORMAD1)
MBS1474521-01 0.02 mg (E-Coli)

Recombinant Human HORMA domain-containing protein 1 (HORMAD1)

Sign In for Pricing
View Details
Recombinant Human HORMA domain-containing protein 1 (HORMAD1)
MBS1474521-02 0.02 mg (Yeast)

Recombinant Human HORMA domain-containing protein 1 (HORMAD1)

Sign In for Pricing
View Details
Recombinant Human HORMA domain-containing protein 1 (HORMAD1)
MBS1474521-03 0.1 mg (E-Coli)

Recombinant Human HORMA domain-containing protein 1 (HORMAD1)

Sign In for Pricing
View Details
Recombinant Human HORMA domain-containing protein 1 (HORMAD1)
MBS1474521-04 0.1 mg (Yeast)

Recombinant Human HORMA domain-containing protein 1 (HORMAD1)

Sign In for Pricing
View Details
Recombinant Human HORMA domain-containing protein 1 (HORMAD1)
MBS1474521-05 0.02 mg (Baculovirus)

Recombinant Human HORMA domain-containing protein 1 (HORMAD1)

Sign In for Pricing
View Details
Recombinant Human HORMA domain-containing protein 1 (HORMAD1)
MBS1474521-06 0.02 mg (Mammalian-Cell)

Recombinant Human HORMA domain-containing protein 1 (HORMAD1)

Sign In for Pricing
View Details