Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDIT3 Peptide - N-terminal region

DDIT3 Peptide - N-terminal region

Product Specifications

UniProt

F8VS99

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDIT3 Rabbit Polyclonal Antibody (orb573857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001181985

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABA T-1 Rabbit Polyclonal Antibody
APRab11230-01 20 µL

GABA T-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GABA T-1 Rabbit Polyclonal Antibody
APRab11230-02 50 µL

GABA T-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GABA T-1 Rabbit Polyclonal Antibody
APRab11230-03 100 µL

GABA T-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GABA T-1 Rabbit Polyclonal Antibody
APRab11230-04 200 µL

GABA T-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
USP49 Protein Vector (Human) (pPB-N-His)
PV045534 500 ng

USP49 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
WDR63 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
50355064 1.0 µg DNA

WDR63 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details