Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL6 Peptide - C-terminal region

BCL6 Peptide - C-terminal region

Product Specifications

UniProt

A5PL18

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCL6 Rabbit Polyclonal Antibody (orb573924) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A2LD1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
10926124 3x 1.0µg DNA

A2LD1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
BMP15 Rabbit Polyclonal Antibody
orb258514 100 µg

BMP15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRP44 Antibody (C-term) Blocking peptide
MBS9220267-01 0.5 mg

BRP44 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
BRP44 Antibody (C-term) Blocking peptide
MBS9220267-02 5x 0.5 mg

BRP44 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
CD44 (NM_001001389) Human Tagged ORF Clone Lentiviral Particle
RC202455L3V 200 µL

CD44 (NM_001001389) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Fmnl2 (NM_172409) Mouse Untagged Clone
MC223481 10 µg

Fmnl2 (NM_172409) Mouse Untagged Clone

Sign In for Pricing
View Details