Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL6 Peptide - C-terminal region

BCL6 Peptide - C-terminal region

Product Specifications

UniProt

A5PL18

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCL6 Rabbit Polyclonal Antibody (orb573924) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fevipiprant-13CD3
TRC-F321757-50MG 50 mg

Fevipiprant-13CD3

Sign In for Pricing
View Details
Akap7 (NM_001001801) Rat Tagged Lenti ORF Clone
RR209617L4 10 µg

Akap7 (NM_001001801) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GNPAT Rabbit Polyclonal Antibody (PE-Cy5)
orb882833 100 µL

GNPAT Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
SETMAR Protein Vector (Mouse) (pPM-C-HA)
PV228380 500 ng

SETMAR Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human B7-H7 (C-mFc)
BP1013-50ug 50 µg

Recombinant Human B7-H7 (C-mFc)

Sign In for Pricing
View Details
anti-MS4A5
YF-PA20497 50 ul

anti-MS4A5

Sign In for Pricing
View Details