NR2E3 Peptide - middle region
NR2E3 Peptide - middle region
Product Specifications
Product Name Alternative
ESCS, PNR, RNR, RP37, rd7
UniProt
Q9Y5X4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NR2E3 Rabbit Polyclonal Antibody (orb574110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057430
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A01595-1-Dylight550 100 µg
Anti-NEDD4-2/NEDD4L Antibody Picoband® (Dylight550 Conjugate)
Sign In for Pricing
View Details RC205162 10 µg
Angiotensin II Type 1 Receptor (AGTR1) (NM_009585) Human Tagged ORF Clone
Sign In for Pricing
View Details NBP3-12854IR 0.1 mL
Mouse Monoclonal SARS-CoV-2 Spike Antibody (7A4D12) [DyLight 755]
Sign In for Pricing
View Details 
bsm-62567R-PerCP-Cy5.5 100 µL
IL33 Recombinant Antibody, PerCP-Cy5.5 Conjugated
Sign In for Pricing
View Details