Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2E3 Peptide - middle region

NR2E3 Peptide - middle region

Product Specifications

Product Name Alternative

ESCS, PNR, RNR, RP37, rd7

UniProt

Q9Y5X4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NR2E3 Rabbit Polyclonal Antibody (orb574110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057430

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dodecyl-TPP
orb668998-01 50 mg

Dodecyl-TPP

Sign In for Pricing
View Details
Dodecyl-TPP
orb668998-02 250 mg

Dodecyl-TPP

Sign In for Pricing
View Details
Human HME-MMP12 ELISA kit
DDXK-E-MMP12 3x 96 Well Plate

Human HME-MMP12 ELISA kit

Sign In for Pricing
View Details
Sumo3 ORF Vector (Rat) (pORF)
ORF077245 1.0 µg DNA

Sumo3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
TOMM40L siRNA (Rat)
MBS8208134-01 15 nmol

TOMM40L siRNA (Rat)

Sign In for Pricing
View Details
TOMM40L siRNA (Rat)
MBS8208134-02 30 nmol

TOMM40L siRNA (Rat)

Sign In for Pricing
View Details