TBC1D2B Peptide - middle region
TBC1D2B Peptide - middle region
Product Specifications
UniProt
B7ZMF1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBC1D2B Rabbit Polyclonal Antibody (orb324446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KYSSLEAKLCQIESKYLILLQEMKTPVCSEDQGPTREVIAQLLEDALQVE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2164747-01 0.1 mL
PE-Linked Monoclonal Antibody to Neurofilament, Light Polypeptide (NEFL)
Sign In for Pricing
View Details MBS2164747-02 0.2 mL
PE-Linked Monoclonal Antibody to Neurofilament, Light Polypeptide (NEFL)
Sign In for Pricing
View Details MBS2164747-03 0.5 mL
PE-Linked Monoclonal Antibody to Neurofilament, Light Polypeptide (NEFL)
Sign In for Pricing
View Details MBS2164747-04 1 mL
PE-Linked Monoclonal Antibody to Neurofilament, Light Polypeptide (NEFL)
Sign In for Pricing
View Details MBS2164747-05 5 mL
PE-Linked Monoclonal Antibody to Neurofilament, Light Polypeptide (NEFL)
Sign In for Pricing
View Details