TBC1D2B Peptide - middle region
TBC1D2B Peptide - middle region
Product Specifications
UniProt
B7ZMF1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBC1D2B Rabbit Polyclonal Antibody (orb324446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KYSSLEAKLCQIESKYLILLQEMKTPVCSEDQGPTREVIAQLLEDALQVE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV792317 1.0 µg DNA
PCDHGC3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details GTR15256889 1 Vial
Lentiviral mouse Proser2 shRNA (UAS) - Lentiviral mouse Proser2 shRNA (UAS) (25)
Sign In for Pricing
View Details 
A02121-2-Fluoro647 100 µg/Vial
Anti-CYP27A1 Antibody Picoband® Fluoro647 Conjugated
Sign In for Pricing
View Details